Fall Savings30% off everything · Code:
Back
Peptide

LL-37 (CAP-18)

CAS 154947-66-7Research Use Only

The 37-amino-acid human cathelicidin host-defense peptide, studied extensively in the literature for its role in innate immune signaling and antimicrobial research. For laboratory research use only.

$75$52.50WITH CODE FALL
Quantity
$75.00
Bundle & save
Free priority shipping on $250+
Third-party tested
U.S.-synthesized & shipped
Discreet packaging
Secure checkoutVisaMastercardAmerican ExpressDiscover

Card fields are hosted by our payment provider, so card numbers are never received or stored by Ventra. Apple Pay, Google Pay and Link are also available at checkout.

Compound Information

Technical specifications

Molecular Profile

What is this compound?

LL-37 is the sole human cathelicidin-derived host-defense peptide, released from the hCAP-18 precursor protein, and is supplied as a lyophilized powder for in vitro laboratory research use only. It is one of the most extensively characterized antimicrobial peptides in the peer-reviewed literature, studied for its pleiotropic roles in innate immune signaling, membrane interaction, and host-defense research.

Research applications: Commonly used in innate immune signaling studies, antimicrobial peptide research, and membrane-interaction research applications.

Type
Human cathelicidin host-defense peptide (hCAP-18 derived)
CAS Number
154947-66-7
Molecular Weight
4493 g/mol
Formula
C205H340N60O53
Amino Acids
37
Sequence
[LL-37, 37 aa]
PubChem Database
Storage Requirements

Stability Information

Protect from lightTemperature-sensitive
Lyophilized (powder)-20°C · stable long-term
Reconstituted2-8°C · use within 14 days

Sources & References

Peer-reviewed research

Archivum immunologiae et therapiae experimentalis
Cathelicidin LL-37: a multitask antimicrobial peptide
2010PMID 20049649DOI 10.1007/s00005-009-0057-2
Bucki R, Leszczyńska K, Namiot A, et al.
View on PubMed
Pharmacological reports : PR
LL-37: Cathelicidin-related antimicrobial peptide with pleiotropic activity
2016PMID 27117377DOI 10.1016/j.pharep.2016.03.015
Fabisiak A, Murawska N, Fichna J
View on PubMed
BioFactors (Oxford, England)
Unique features of human cathelicidin LL-37
2015PMID 26434733DOI 10.1002/biof.1225
Bandurska K, Berdowska A, Barczyńska-Felusiak R, et al.
View on PubMed

References are provided for qualified researchers as a starting point for literature review. Ventra Sciences makes no claims about the contents of cited works.

For research use only

This product is intended strictly for in vitro laboratory research by qualified professionals. It is not for human or veterinary use and must not be used in food, drugs, diagnostics, or cosmetics. Ventra Sciences makes no medical claims regarding any compound sold. All purchasers acknowledge they will use this product solely for research purposes.

This compound has not been evaluated by the FDA. It is not intended to diagnose, treat, cure, or prevent any disease. All use must comply with applicable institutional, local, and federal regulations.

By purchasing from Ventra Sciences, the buyer affirms they are a qualified researcher or institution. All sales are final. The purchaser assumes full responsibility for handling, use, and regulatory compliance.

Subscribe to our newsletter

Exclusive updates and restock alerts, straight to your inbox.