Peptide

LL-37 (CAP-18)

CAS 154947-66-7 Research Use Only

The 37-amino-acid human cathelicidin host-defense peptide, studied extensively in the literature for its role in innate immune signaling and antimicrobial research. For laboratory research use only.

Quantity
$75.00
Bundle & save
Free priority shipping on $250+
Third-party tested
U.S.-synthesized & shipped
Discreet packaging
Free Amino H2O on orders $150+

Compound Information

Technical specifications

Molecular Profile

What is this compound?

Type
Human cathelicidin host-defense peptide (hCAP-18 derived)
CAS Number
154947-66-7
Molecular Weight
4493 g/mol
Formula
C205H340N60O53
Amino Acids
37
Sequence
[LL-37, 37 aa]
PubChem Database
Storage Requirements

Stability Information

Protect from light Temperature-sensitive
Lyophilized (powder) -20°C · stable long-term
Reconstituted 2-8°C · use within 14 days

Sources & References

Peer-reviewed research

Archivum immunologiae et therapiae experimentalis
Cathelicidin LL-37: a multitask antimicrobial peptide
2010 PMID 20049649 DOI 10.1007/s00005-009-0057-2
Bucki R, Leszczyńska K, Namiot A, et al.
View on PubMed
Pharmacological reports : PR
LL-37: Cathelicidin-related antimicrobial peptide with pleiotropic activity
2016 PMID 27117377 DOI 10.1016/j.pharep.2016.03.015
Fabisiak A, Murawska N, Fichna J
View on PubMed
BioFactors (Oxford, England)
Unique features of human cathelicidin LL-37
2015 PMID 26434733 DOI 10.1002/biof.1225
Bandurska K, Berdowska A, Barczyńska-Felusiak R, et al.
View on PubMed

References are provided for qualified researchers as a starting point for literature review. Ventra Sciences makes no claims about the contents of cited works.

LL-37 is the sole human cathelicidin-derived host-defense peptide, released from the hCAP-18 precursor protein, and is supplied as a lyophilized powder for in vitro laboratory research use only. It is one of the most extensively characterized antimicrobial peptides in the peer-reviewed literature, studied for its pleiotropic roles in innate immune signaling, membrane interaction, and host-defense research.

Product Description

  • The only known human cathelicidin-derived antimicrobial peptide, cleaved from the hCAP-18 precursor
  • Cationic, amphipathic alpha-helix that interacts with anionic microbial membranes in vitro
  • Studied for chemotactic and immunomodulatory signaling through the FPR2/ALX receptor in cell models
  • Investigated in biofilm, epithelial-barrier, and wound-matrix research
  • A heavily cited reference peptide in the innate-immunity literature

Research Use Notes

  • Supplied as lyophilized powder in a sealed vial
  • Requires reconstitution before use; Amino H2O sold separately
  • Appearance: white to off-white lyophilized powder
  • Cationic peptides can adsorb to plastic surfaces; low-binding labware is commonly used in the literature
  • Identity and purity verified by third-party COA

Storage & Handling

  • Store the sealed lyophilized vial frozen (-20C), protected from light
  • Keep refrigerated (2-8C) once reconstituted
  • Do not repeatedly freeze and thaw reconstituted material

Intended Use:

This compound is intended strictly for in vitro laboratory research by qualified professionals.
It is not for human or veterinary use and must not be used in food, drugs, diagnostics, or cosmetics.

Disclaimer:

This compound has not been evaluated by the FDA.
It is not intended to diagnose, treat, cure, or prevent any disease.
All use must comply with applicable institutional, local, and federal regulations.

Terms of Sale:

By purchasing from Ventra Sciences, the buyer affirms they are a qualified researcher or institution.
All sales are final. The purchaser assumes full responsibility for handling, use, and regulatory compliance.

Research applications: Commonly used in innate immune signaling studies, antimicrobial peptide research, and membrane-interaction research applications.

For laboratory research use only. Not a drug, cosmetic, supplement, or food. Not for human or animal consumption.

This product is intended strictly for in vitro laboratory research by qualified professionals. It is not for human or veterinary use and must not be used in food, drugs, diagnostics, or cosmetics. Ventra Sciences makes no medical claims regarding any compound sold. All purchasers acknowledge they will use this product solely for research purposes.

Ventra Sciences — Welcome Offer
For Research Use Only · 21+
New Customer Offer

Try your luck.

Scratch the card below with your finger or mouse.

You Won
10%
OFF
Scratch Here
Scratch the card to continue
10% Off Unlocked
Almost Yours

Where should we
send your code?

Drop your email and we'll unlock your 10% off welcome code.

By continuing you agree to receive Ventra Sciences emails. Unsubscribe anytime. Research use only.

10% Off Unlocked
Your Reward

You're in.
Here's your code.

Welcome Code
VNTWELCOME10
Shop Now →

Code expires in 7 days. One use per customer. Valid on first order.